Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab31 Rabbit Polyclonal Antibody (HRP)

Rab31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rab0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Rab31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAEC00344-50UG - Fyn Antibody (Phospho-Tyr530)
OAEC00344-50UG 50 µg

OAEC00344-50UG - Fyn Antibody (Phospho-Tyr530)

Sign In for Pricing
View Details
Mouse Chtf8 (BC023107) AAV Particle
MR208540A1V 250 µL

Mouse Chtf8 (BC023107) AAV Particle

Sign In for Pricing
View Details
CLIP3 Rabbit Polyclonal Antibody
APRab09046-01 20 µL

CLIP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLIP3 Rabbit Polyclonal Antibody
APRab09046-02 50 µL

CLIP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLIP3 Rabbit Polyclonal Antibody
APRab09046-03 100 µL

CLIP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLIP3 Rabbit Polyclonal Antibody
APRab09046-04 200 µL

CLIP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details