Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Rabbit Polyclonal Antibody (FITC)

PITPNB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VIB1B, PtdInsTP, PI-TP-beta

UniProt

B7Z7Q0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PITPNB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001271206.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp366 (NM_001004149) Mouse Tagged ORF Clone Lentiviral Particle
MR210431L4V 200 µL

Zfp366 (NM_001004149) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRAIL (TNF-Related Apoptosis Inducing Ligand, Apo2 Ligand) (MaxLight 650)
MBS6220215-01 0.1 mL

TRAIL (TNF-Related Apoptosis Inducing Ligand, Apo2 Ligand) (MaxLight 650)

Sign In for Pricing
View Details
TRAIL (TNF-Related Apoptosis Inducing Ligand, Apo2 Ligand) (MaxLight 650)
MBS6220215-02 5x 0.1 mL

TRAIL (TNF-Related Apoptosis Inducing Ligand, Apo2 Ligand) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Glutaredoxin-1 ELISA Kit
EK3155 Inquire

Mouse Glutaredoxin-1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Horse IgG (H&L) - Alexa Fluor 750
E51S4120 100 µL

Rabbit Anti-Horse IgG (H&L) - Alexa Fluor 750

Sign In for Pricing
View Details
IL28RA Rabbit Polyclonal Antibody (HRP)
orb2114900 100 µL

IL28RA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details