IL28RA Rabbit Polyclonal Antibody (HRP)
IL28RA Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1
UniProt
Q5VTX8
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
Field of Research
Infectious Disease & Virology
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
54kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Tested Applications
WB
NCBI Accession Number
NP_775087
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal DC-SIGN/CD209 Antibody (MMD3R) [PE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FAB83451RP 0.1 mL
Mouse Monoclonal DC-SIGN/CD209 Antibody (MMD3R) [PE]
Sign In for Pricing
View Details 
![PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
MBS6330851-01 0.1 mL
PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)
Sign In for Pricing
View Details ![PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
MBS6330851-02 5x 0.1 mL
PARP1, NT (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)
Sign In for Pricing
View Details GTR15166394 1 Vial
Lentiviral mouse Tmem72 shRNA (UAS) - Lentiviral mouse Tmem72 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details