Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Rabbit Polyclonal Antibody (FITC)

PITPNB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VIB1B, PtdInsTP, PI-TP-beta

UniProt

B7Z7Q0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PITPNB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001271206.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADAMTS6 sgRNA gene knockout kit - Lentiviral human ADAMTS6 sgRNA gene knockout kit (25)
GTR15359604 1 Vial

Lentiviral human ADAMTS6 sgRNA gene knockout kit - Lentiviral human ADAMTS6 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 550)
MBS6357072-01 0.1 mL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 550)

Sign In for Pricing
View Details
TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 550)
MBS6357072-02 5x 0.1 mL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 550)

Sign In for Pricing
View Details
Anti-SLC6A15 Rabbit pAb
GB112042-50 50 μL

Anti-SLC6A15 Rabbit pAb

Sign In for Pricing
View Details
E2F4 3'UTR GFP Stable Cell Line
TU056504 1.0 mL

E2F4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-SARS-E2 Monoclonal Antibody
M00501 100 µL

Anti-SARS-E2 Monoclonal Antibody

Sign In for Pricing
View Details