Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSL1 Rabbit Polyclonal Antibody (HRP)

NSL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DC8, MIS14, C1orf48

UniProt

Q96IY1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIET

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_056286

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHA 568487 free base
orb1305714-01 10 mg

PHA 568487 free base

Sign In for Pricing
View Details
PHA 568487 free base
orb1305714-02 25 mg

PHA 568487 free base

Sign In for Pricing
View Details
PHA 568487 free base
orb1305714-03 50 mg

PHA 568487 free base

Sign In for Pricing
View Details
PHA 568487 free base
orb1305714-04 100 mg

PHA 568487 free base

Sign In for Pricing
View Details
PHA 568487 free base
orb1305714-05 200 mg

PHA 568487 free base

Sign In for Pricing
View Details
Dermcidin Polyclonal Antibody, RBITC Conjugated
bs-12996R-RBITC 100 µL

Dermcidin Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details