Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNBL1 Rabbit Polyclonal Antibody (HRP)

CTNNBL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAP, P14L, PP8304, C20orf33, dJ633O20.1

UniProt

Q8WYA6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_110517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf7 (CDC123) Mouse Monoclonal Antibody [Clone ID: OTI5C7]
CF505694 100 µg

C10orf7 (CDC123) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

Sign In for Pricing
View Details
CD11c Polyclonal Antibody APC Conjugated
MBS9463443-01 0.1 mL

CD11c Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
CD11c Polyclonal Antibody APC Conjugated
MBS9463443-02 5x 0.1 mL

CD11c Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
Recombinant human VAT1 protein
ATGP1339-010 10 µg

Recombinant human VAT1 protein

Sign In for Pricing
View Details
Thyroid Hormone Receptor Interactor 6 (TRIP6) Polyclonal Antibody
CAU22088-01 100 µL

Thyroid Hormone Receptor Interactor 6 (TRIP6) Polyclonal Antibody

Sign In for Pricing
View Details
Thyroid Hormone Receptor Interactor 6 (TRIP6) Polyclonal Antibody
CAU22088-02 200 µL

Thyroid Hormone Receptor Interactor 6 (TRIP6) Polyclonal Antibody

Sign In for Pricing
View Details