Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD48 Rabbit Polyclonal Antibody (HRP)

CD48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BCM1, BLAST, hCD48, mCD48, BLAST1, SLAMF2, MEM-102

UniProt

P09326

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001769

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD6, ID (SMAD6, MADH6, Mothers against decapentaplegic homolog 6, SMAD family member 6) (MaxLight 490) discontinued
042026-ML490 100 µL

SMAD6, ID (SMAD6, MADH6, Mothers against decapentaplegic homolog 6, SMAD family member 6) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SNX10 Peptide - middle region
orb2001370 100 µg

SNX10 Peptide - middle region

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) DACD Polyclonal Antibody
MBS9010094 Inquire

Rabbit anti-Escherichia coli (strain K12) DACD Polyclonal Antibody

Sign In for Pricing
View Details
Spirulina Extract
C02714-5mg 5 mg

Spirulina Extract

Sign In for Pricing
View Details
DL-Aspartic acid
GM6777-1kg 1 Kg

DL-Aspartic acid

Sign In for Pricing
View Details
Recombinant Shigella Boydii SBO_3372 Protein (aa 1-252)
VAng-Lsx08852-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii SBO_3372 Protein (aa 1-252)

Sign In for Pricing
View Details