What is the catalog number for SNX10 Peptide - middle region?

The catalog number for SNX10 Peptide - middle region is orb2001370.

What sizes are available for SNX10 Peptide - middle region?

SNX10 Peptide - middle region is available in the following size(s): 100 µg.

Is SNX10 Peptide - middle region in stock?

SNX10 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SNX10 Peptide - middle region

Product Specifications

Product Name Alternative

OPTB8

UniProt

Q9Y5X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001186764.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-426289-NIC 20 µg

SerpinB11 Double Nickase Plasmid (m)

Sign In for Pricing

View Details

bsm-61609R-PE-Cy7-01 20 µL

HSD11B1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing

View Details

bsm-61609R-PE-Cy7-02 100 µL

HSD11B1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing

View Details

OAPC00094-100UL 100 µL

Anti-Collagen I alpha 1 Propeptide Sequence

Sign In for Pricing

View Details

MBS8308922-01 1 mg

PPP1R16B Blocking Peptide

Sign In for Pricing

View Details

MBS8308922-02 5 mg

PPP1R16B Blocking Peptide

Sign In for Pricing

View Details