Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHF Rabbit Polyclonal Antibody (HRP)

SHF Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7M4L6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SHF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADERISGPPASSDRLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morc2b Protein Vector (Rat) (pPB-C-His)
PV282766 500 ng

Morc2b Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
SLC17A3 Peptide - middle region
orb2001445 100 µg

SLC17A3 Peptide - middle region

Sign In for Pricing
View Details
RMND5B Antibody (C-term) Blocking Peptide
MBS9224833-01 0.5 mg

RMND5B Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
RMND5B Antibody (C-term) Blocking Peptide
MBS9224833-02 5x 0.5 mg

RMND5B Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)
316892-01 50 µg

Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)

Sign In for Pricing
View Details
Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)
316892-02 100 µg

Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)

Sign In for Pricing
View Details