Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC17A3 Peptide - middle region

SLC17A3 Peptide - middle region

Product Specifications

Product Name Alternative

NPT4

UniProt

O00476

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001091956.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQNVIMNITMVAMVNSTSPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D4B (NM_207372) Human Recombinant Protein
TP762474 50 µg

SH2D4B (NM_207372) Human Recombinant Protein

Sign In for Pricing
View Details
ADGRD1 Polyclonal Antibody
E-AB-90432-01 60 µL

ADGRD1 Polyclonal Antibody

Sign In for Pricing
View Details
ADGRD1 Polyclonal Antibody
E-AB-90432-02 120 µL

ADGRD1 Polyclonal Antibody

Sign In for Pricing
View Details
ADGRD1 Polyclonal Antibody
E-AB-90432-03 200 µL

ADGRD1 Polyclonal Antibody

Sign In for Pricing
View Details
WDR54 (NM_032118) Human Recombinant Protein
TP308682L 1 mg

WDR54 (NM_032118) Human Recombinant Protein

Sign In for Pricing
View Details
TFPI2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]
TA805209AM 100 µL

TFPI2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details