Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1R1 Rabbit Polyclonal Antibody (HRP)

IL1R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P80, IL1R, IL1RA, CD121A, D2S1473, IL-1R-alpha

UniProt

P14778

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decanoyl-L-carnitine Chloride
TRC-D212580-250MG 250 mg

Decanoyl-L-carnitine Chloride

Sign In for Pricing
View Details
CCR9 Recombinant Rabbit Monoclonal Antibody [JE00-35]
HA722444 100 µL

CCR9 Recombinant Rabbit Monoclonal Antibody [JE00-35]

Sign In for Pricing
View Details
Tissue FFPE Sections, Smooth muscle
CS700731 5x 5 µm

Tissue FFPE Sections, Smooth muscle

Sign In for Pricing
View Details
Slc6a20b Mouse Gene Knockout Kit (CRISPR)
KN516178 1 Kit

Slc6a20b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
E-AB-19022-01 20 µL

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
E-AB-19022-02 60 µL

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details