Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ6 Rabbit Polyclonal Antibody (Biotin)

COQ6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGI10, CGI-10, COQ10D6

UniProt

Q9Y2Z9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_872286

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (KRT10/844), CF640R conjugate, 0.1mg/mL
BNC400844-500 1x 500 µL

Cytokeratin 10 (KRT10/844), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human STAT3 Protein (His Tag)
PKSH033057-01 10 µg

Recombinant Human STAT3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human STAT3 Protein (His Tag)
PKSH033057-02 50 µg

Recombinant Human STAT3 Protein (His Tag)

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF488A conjugate, 0.1mg/mL
BNC881563-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW07F4-CON A 10x 96 Well Plates

Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD58 Antibody[TS2/9.1]
E-AB-F1068G-01 20 Tests

PE/Cyanine5 Anti-Human CD58 Antibody[TS2/9.1]

Sign In for Pricing
View Details