Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CINP Rabbit Polyclonal Antibody (FITC)

CINP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CINP

UniProt

Q9BW66

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CINP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)
orb2903997-01 20 µg

Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)

Sign In for Pricing
View Details
Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)
orb2903997-02 100 µg

Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2012006-01 0.01 mg

Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2012006-02 0.05 mg

Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2012006-03 0.1 mg

Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)
MBS2012006-04 0.2 mg

Recombinant Sialic Acid Binding Ig Like Lectin 7 (SIGLEC7)

Sign In for Pricing
View Details