Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)

This Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1) spans the amino acid sequence from region 1-477.

Product Specifications

Product Name Alternative

C3a anaphylatoxin chemotactic receptor, C3AR, C3a-R, Complement component 3a receptor 1

UniProt

O09047

Expression Region

1-477

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESFDADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGVKMKTTVNTVW FLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDR CLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSR SYDYWDYVYKLSLPESNSTDNSTAQLTGHMNDRSAPSSVQARDYFWTVTTALQSQPFLTS PEDSFSLDSANQQPHYGGKPPNVLTAAVPSGFPVEDRKSNTLNADAFLSAHTELFPTASS GHLYPYDFQGDYVDQFTYDNHVPTPLMAITITRLVVGFLVPFFIMVICYSLIVFRMRKTN FTKSRNKTFRVAVAVVTVFFICWTPYHLVGVLLLITDPESSLGEAVMSWDHMSIALASAN SCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTNCTQDKASSKRNNMSTDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvin gamma (PARVG) (NM_001137605) Human Recombinant Protein
TP326988L 1 mg

Parvin gamma (PARVG) (NM_001137605) Human Recombinant Protein

Sign In for Pricing
View Details
GMPR2 (NM_001002001) Human Over-expression Lysate
LY424315 100 µg

GMPR2 (NM_001002001) Human Over-expression Lysate

Sign In for Pricing
View Details
Sec22c Mouse Gene Knockout Kit (CRISPR)
KN515459 1 Kit

Sec22c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17) Human Knockdown Lysate
LY300360 100 µg

Cytokeratin 17 (KRT17) Human Knockdown Lysate

Sign In for Pricing
View Details
CEP27 (HAUS2) (NM_001130447) Human Over-expression Lysate
LY427213 100 µg

CEP27 (HAUS2) (NM_001130447) Human Over-expression Lysate

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF640R conjugate, 0.1mg/mL
BNC400500-500 1x 500 µL

Progesterone Receptor (PR500), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details