Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP2 Rabbit Polyclonal Antibody (FITC)

STXBP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

UniProt

Q15833

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_008880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRS Protein Vector (Human) (pPM-C-HA)
PV113556 500 ng

PRS Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PSPC1 Peptide - C-terminal region
orb2000381 100 µg

PSPC1 Peptide - C-terminal region

Sign In for Pricing
View Details
Serotonin N acetyltransferase (AANAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E1]
TA810161AM 100 µL

Serotonin N acetyltransferase (AANAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E1]

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus rpsB Protein (aa 1-258)
VAng-Cr6169-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus rpsB Protein (aa 1-258)

Sign In for Pricing
View Details
HOOK2 Protein Lysate (Mouse) with C-HA Tag
23788034 100 µg

HOOK2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
MAb to Cryptosporidium
MBS313146-01 1 mg

MAb to Cryptosporidium

Sign In for Pricing
View Details