Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSPC1 Peptide - C-terminal region

PSPC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSP1

UniProt

Q8WXF1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSPC1 Rabbit Polyclonal Antibody (orb589055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001035879

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taxol F
466869-01 1 mg

Taxol F

Sign In for Pricing
View Details
Taxol F
466869-02 2.5 mg

Taxol F

Sign In for Pricing
View Details
OR1S1 shRNA (h) Lentiviral Particles
sc-96595-V 200 µL

OR1S1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
(3R,4R) -1- (tert-Butoxycarbonyl) -3- (4-chlorophenyl) piperidine-4-carboxylic acid
OR1035689-01 25 mg

(3R,4R) -1- (tert-Butoxycarbonyl) -3- (4-chlorophenyl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details
(3R,4R) -1- (tert-Butoxycarbonyl) -3- (4-chlorophenyl) piperidine-4-carboxylic acid
OR1035689-02 50 mg

(3R,4R) -1- (tert-Butoxycarbonyl) -3- (4-chlorophenyl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details
(3R,4R) -1- (tert-Butoxycarbonyl) -3- (4-chlorophenyl) piperidine-4-carboxylic acid
OR1035689-03 100 mg

(3R,4R) -1- (tert-Butoxycarbonyl) -3- (4-chlorophenyl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details