Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF16 Rabbit Polyclonal Antibody (Biotin)

FGF16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MF4, FGF-16

UniProt

O43320

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Creatine Kinase ELISA Kit
MBS7257660-01 48 Well

Guinea Pig Creatine Kinase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Creatine Kinase ELISA Kit
MBS7257660-02 96 Well

Guinea Pig Creatine Kinase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Creatine Kinase ELISA Kit
MBS7257660-03 5x 96 Well

Guinea Pig Creatine Kinase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Creatine Kinase ELISA Kit
MBS7257660-04 10x 96 Well

Guinea Pig Creatine Kinase ELISA Kit

Sign In for Pricing
View Details
WRN Helicase Activity Assay Kit
78852-1 96 Reactions

WRN Helicase Activity Assay Kit

Sign In for Pricing
View Details
Recombinant Hepatitis C HCV Core Genotype-5 Protein, Untagged, E.coli-500ug
QP12154-500ug 500ug

Recombinant Hepatitis C HCV Core Genotype-5 Protein, Untagged, E.coli-500ug

Sign In for Pricing
View Details