Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Rabbit Polyclonal Antibody (HRP)

LPAR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LPA4, P2Y9, GPR23, P2RY9, P2Y5-LIKE

UniProt

Q99677

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005287

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS800071 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
TNF-alpha Recombinant Protein
40-609 0.05 mg

TNF-alpha Recombinant Protein

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)
MBS1294426-01 0.02 mg (E-Coli)

Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)
MBS1294426-02 0.1 mg (E-Coli)

Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)
MBS1294426-03 0.02 mg (Yeast)

Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)
MBS1294426-04 0.1 mg (Yeast)

Recombinant Vibrio vulnificus UPF0325 protein VV1_1856 (VV1_1856)

Sign In for Pricing
View Details