Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Rabbit Polyclonal Antibody (Biotin)

IL26 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKAAWLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleaning solution for cosmetic industry (fats and oils) (500 ml bottle)
HI70630L 500 mL

Cleaning solution for cosmetic industry (fats and oils) (500 ml bottle)

Sign In for Pricing
View Details
ZNF174 293 Cell Lysate
409705 0.1 mg

ZNF174 293 Cell Lysate

Sign In for Pricing
View Details
SF3A2 Peptide - N-terminal region
orb2002228 100 µg

SF3A2 Peptide - N-terminal region

Sign In for Pricing
View Details
MYCBP2 Human shRNA Plasmid Kit (Locus ID 23077)
TR311322 1 Kit

MYCBP2 Human shRNA Plasmid Kit (Locus ID 23077)

Sign In for Pricing
View Details
GLI1 Polyclonal Antibody
ANT-12354-50ug 50 µg

GLI1 Polyclonal Antibody

Sign In for Pricing
View Details
Zika virus (strain Zika SPH2015) Envelope Protein (ZIKV-E) ELISA Kit
MBS8123982-01 96 Tests

Zika virus (strain Zika SPH2015) Envelope Protein (ZIKV-E) ELISA Kit

Sign In for Pricing
View Details