Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3A2 Peptide - N-terminal region

SF3A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SF3A2, SAP62

UniProt

Q15428

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3A2 Rabbit Polyclonal Antibody (orb588109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_009096

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rae-1δ (Charlotte 1.23) : m-IgGκ BP-HRP Bundle
sc-534174 1 Kit

Rae-1δ (Charlotte 1.23) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Elongin A (TCEB3) (NM_003198) Human Untagged Clone
SC328012 10 µg

Elongin A (TCEB3) (NM_003198) Human Untagged Clone

Sign In for Pricing
View Details
Phospho-Src (Tyr418) Rabbit pAb, BF700 conjugated
orb2825520 100 µL

Phospho-Src (Tyr418) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
1810022K09Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
10294064 1.0 µg DNA

1810022K09Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human DCUN1D1 shRNA (UAS) - Lentiviral human DCUN1D1 shRNA (UAS, GFP) plasmid
GTR15317881 1 Vial

Lentiviral human DCUN1D1 shRNA (UAS) - Lentiviral human DCUN1D1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Phosphodiesterase 12 (PDE12) ELISA Kit
MBS2705881-01 24 Strip Well

Mouse Phosphodiesterase 12 (PDE12) ELISA Kit

Sign In for Pricing
View Details