Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3A2 Peptide - N-terminal region

SF3A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SF3A2, SAP62

UniProt

Q15428

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3A2 Rabbit Polyclonal Antibody (orb588109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_009096

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPRT (NM_014298) Human Recombinant Protein
TP302960L 1 mg

QPRT (NM_014298) Human Recombinant Protein

Sign In for Pricing
View Details
Fmoc-S-carboxyethyl-L-cysteine
sc-327847A 5 g

Fmoc-S-carboxyethyl-L-cysteine

Sign In for Pricing
View Details
NOSTRIN Polyclonal Antibody, Cy5.5 Conjugated
bs-13694R-Cy5.5 100 µL

NOSTRIN Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Zfp648 shRNA (UAS) - Lentiviral mouse Zfp648 shRNA (UAS, GFP) (100)
GTR15246045 1 Vial

Lentiviral mouse Zfp648 shRNA (UAS) - Lentiviral mouse Zfp648 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Benzyl benzoate 10g
A14577-10000 10000 mg

Benzyl benzoate 10g

Sign In for Pricing
View Details
UHMK1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV662291 1.0 µg DNA

UHMK1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details