Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Rabbit Polyclonal Antibody (HRP)

LILRA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HM31, HM43, ILT6, LIR4, CD85E, ILT-6, LIR-4

UniProt

Q8N6C8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LILRA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_006856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFITM10 Human Over-expression Lysate
orb1339468 100 µg

IFITM10 Human Over-expression Lysate

Sign In for Pricing
View Details
MIRacle™ mmu-miR-21c miRNA Agomir/Antagomir
AM3486 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-21c miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Nek5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
31712114 3x 1.0 µg

Nek5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
GSDMB Polyclonal Antibody
A59314-020 20 µL

GSDMB Polyclonal Antibody

Sign In for Pricing
View Details
INO80A Double Nickase Plasmid (m)
sc-426940-NIC 20 µg

INO80A Double Nickase Plasmid (m)

Sign In for Pricing
View Details
GOLGA6L6 CRISPR/Cas9 KO Plasmid (h)
sc-416668 20 µg

GOLGA6L6 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details