Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP17 Rabbit Polyclonal Antibody (FITC)

RANBP17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H2T7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human RANBP17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075048.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBAS, ID (GBAS, NIPSNAP2, Protein NipSnap homolog 2, Glioblastoma-amplified sequence)
035936 200 µL

GBAS, ID (GBAS, NIPSNAP2, Protein NipSnap homolog 2, Glioblastoma-amplified sequence)

Sign In for Pricing
View Details
Human Macrophage-Derived Chemokine, MDC ELISA Kit
MBS164207-01 48 Well

Human Macrophage-Derived Chemokine, MDC ELISA Kit

Sign In for Pricing
View Details
Human Macrophage-Derived Chemokine, MDC ELISA Kit
MBS164207-02 96 Well

Human Macrophage-Derived Chemokine, MDC ELISA Kit

Sign In for Pricing
View Details
Human Macrophage-Derived Chemokine, MDC ELISA Kit
MBS164207-03 5x 96 Well

Human Macrophage-Derived Chemokine, MDC ELISA Kit

Sign In for Pricing
View Details
Human Macrophage-Derived Chemokine, MDC ELISA Kit
MBS164207-04 10x 96 Well

Human Macrophage-Derived Chemokine, MDC ELISA Kit

Sign In for Pricing
View Details
Recombinant Disulfide bond formation protein B (dsbB)
orb2919853-01 20 µg

Recombinant Disulfide bond formation protein B (dsbB)

Sign In for Pricing
View Details