Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Disulfide bond formation protein B (dsbB)

This Recombinant Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

P59343

Expression Region

1-176

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMARFPEWLPLDKWV PQVFVASGDCAERQWEFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cas9 | CRISPR-associated endonuclease 9 (polyclonal) - DyLight® 650 conjugated (40 µg)
AS16 3690-DL650 40 µg

Anti-Cas9 | CRISPR-associated endonuclease 9 (polyclonal) - DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
2-Mercaptobenzoic Acid
TRC-M251700-10G 10 g

2-Mercaptobenzoic Acid

Sign In for Pricing
View Details
Anti-M-cadherin
Y058116 100 µg

Anti-M-cadherin

Sign In for Pricing
View Details
TMEM238 Human Gene Knockout Kit (CRISPR)
KN431017 1 Kit

TMEM238 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAK (PTK2) pTyr861 Rabbit Polyclonal Antibody
AP20811PU-N 100 µg

FAK (PTK2) pTyr861 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Olig2 Antibody
RC-15326-01 50 μL

Recombinant Olig2 Antibody

Sign In for Pricing
View Details