Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPSM1 Rabbit Polyclonal Antibody (Biotin)

GPSM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AGS3

UniProt

Q86YR5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPSM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139110

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human Guanylate kinase 1/GUK1 protein
ATGP0690-020 20 µg

Recombinant human Guanylate kinase 1/GUK1 protein

Sign In for Pricing
View Details
Lentiviral mouse Scgb1b29 shRNA (UAS) - Lentiviral mouse Scgb1b29 shRNA (UAS, RFP) (100)
GTR15306447 1 Vial

Lentiviral mouse Scgb1b29 shRNA (UAS) - Lentiviral mouse Scgb1b29 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin(56-210), Frataxin(81-210), FRDA, X25) (MaxLight 550)
MBS6211593-01 0.1 mL

FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin(56-210), Frataxin(81-210), FRDA, X25) (MaxLight 550)

Sign In for Pricing
View Details
FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin(56-210), Frataxin(81-210), FRDA, X25) (MaxLight 550)
MBS6211593-02 5x 0.1 mL

FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin(56-210), Frataxin(81-210), FRDA, X25) (MaxLight 550)

Sign In for Pricing
View Details
CXCL11/I-TAC BioAssayTM ELISA Kit, Human
143792 96 Tests

CXCL11/I-TAC BioAssayTM ELISA Kit, Human

Sign In for Pricing
View Details
Lentiviral human PARP16 shRNA (UAS) - Lentiviral human PARP16 shRNA (UAS, iRFP) (25)
GTR15133886 1 Vial

Lentiviral human PARP16 shRNA (UAS) - Lentiviral human PARP16 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details