Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2AG1 Rabbit Polyclonal Antibody (FITC)

OR2AG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR2AG3, OR11-79

UniProt

Q9H205

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2AG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYA4 Rabbit Polyclonal Antibody (HRP)
orb1596302 100 µL

EYA4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)
orb2917274-01 20 µg

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)
orb2917274-02 100 µg

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Lentiviral mouse Mrpl30 shRNA (UAS) - Lentiviral mouse Mrpl30 shRNA (UAS) plasmid
GTR15200839 1 Vial

Lentiviral mouse Mrpl30 shRNA (UAS) - Lentiviral mouse Mrpl30 shRNA (UAS) plasmid

Sign In for Pricing
View Details
General Transcription Factor IIH, Polypeptide 5 (GTF2H5), Recombinant, Human, His-Tag
050020-01 10 µg

General Transcription Factor IIH, Polypeptide 5 (GTF2H5), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
General Transcription Factor IIH, Polypeptide 5 (GTF2H5), Recombinant, Human, His-Tag
050020-02 50 µg

General Transcription Factor IIH, Polypeptide 5 (GTF2H5), Recombinant, Human, His-Tag

Sign In for Pricing
View Details