Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7A0C2

Expression Region

1-242

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TLR2 ELISA Kit
EF012921 96 Tests

Mouse TLR2 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) RHTA Polyclonal Antibody
MBS7163173 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) RHTA Polyclonal Antibody

Sign In for Pricing
View Details
Kinesis EVOL Plunger; 50ul
CHR2135 1 Each

Kinesis EVOL Plunger; 50ul

Sign In for Pricing
View Details
UTY Peptide - C-terminal region
MBS3244095-01 0.1 mg

UTY Peptide - C-terminal region

Sign In for Pricing
View Details
UTY Peptide - C-terminal region
MBS3244095-02 5x 0.1 mg

UTY Peptide - C-terminal region

Sign In for Pricing
View Details
Cyclohexanecarboxylic-d11 Acid
163235 50 mg

Cyclohexanecarboxylic-d11 Acid

Sign In for Pricing
View Details