Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NADSYN1 Rabbit Polyclonal Antibody (Biotin)

NADSYN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VCRL3

UniProt

Q6IA69

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060631

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GnRH-Receptor (LHRH Receptor) (A9E4), CF594 conjugate, 0.1mg/mL
BNC940309-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (A9E4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(±)-2-Hydroxydodecanoic Acid
TRC-H296750-50MG 50 mg

(±)-2-Hydroxydodecanoic Acid

Sign In for Pricing
View Details
COG1 Human shRNA Plasmid Kit (Locus ID 9382)
TR305310 1 Kit

COG1 Human shRNA Plasmid Kit (Locus ID 9382)

Sign In for Pricing
View Details
RASAL2 Rabbit Polyclonal Antibody (HRP)
orb2089517 100 µL

RASAL2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal USF2 Antibody [Alexa Fluor 594]
NBP1-92647AF594 0.1 mL

Rabbit Polyclonal USF2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
CD86 (Activation B7-2 antigen, B lymphocyte activation antigen B72, CD28 antigen ligand 2, CD28LG2, CLS1, CTLA-4 counter-receptor B7.2, Early T-cell costimulatory molecule 1, ETC-1, FUN-1, LAB72, Ly-58, MB7-2, TS/A-2) (BSA & Azide Free) (MaxLight 405) discontinued
168723-AF-ML405 100 µL

CD86 (Activation B7-2 antigen, B lymphocyte activation antigen B72, CD28 antigen ligand 2, CD28LG2, CLS1, CTLA-4 counter-receptor B7.2, Early T-cell costimulatory molecule 1, ETC-1, FUN-1, LAB72, Ly-58, MB7-2, TS/A-2) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details