Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASAL2 Rabbit Polyclonal Antibody (HRP)

RASAL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NGAP

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASAL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPVEGGQEQQTDSTKGRCLRRTVSVPSEGQFPEYPPEGATKLEVPAERSP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_733793

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp280b (NM_177475) Mouse Tagged Lenti ORF Clone
MR208561L3 10 µg

Zfp280b (NM_177475) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Benzenamine, 4,4'- (21H,23H-Porphine-5,15-Diyl) Bis-
OR1023941-01 100 mg

Benzenamine, 4,4'- (21H,23H-Porphine-5,15-Diyl) Bis-

Sign In for Pricing
View Details
Benzenamine, 4,4'- (21H,23H-Porphine-5,15-Diyl) Bis-
OR1023941-02 250 mg

Benzenamine, 4,4'- (21H,23H-Porphine-5,15-Diyl) Bis-

Sign In for Pricing
View Details
Benzenamine, 4,4'- (21H,23H-Porphine-5,15-Diyl) Bis-
OR1023941-03 1 g

Benzenamine, 4,4'- (21H,23H-Porphine-5,15-Diyl) Bis-

Sign In for Pricing
View Details
Rabbit PKBg ELISA Kit
ERTP0107 96 Tests

Rabbit PKBg ELISA Kit

Sign In for Pricing
View Details
B7H6 ELISA Kit (Human) (OKEH01750)
OKEH01750 96 Well

B7H6 ELISA Kit (Human) (OKEH01750)

Sign In for Pricing
View Details