Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A1 Rabbit Polyclonal Antibody (HRP)

OR52A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HPFH1OR

UniProt

Q9UKL2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Vigilin (HDLBP), partial
orb2659752-01 20 µg

Recombinant Human Vigilin (HDLBP), partial

Sign In for Pricing
View Details
Recombinant Human Vigilin (HDLBP), partial
orb2659752-02 100 µg

Recombinant Human Vigilin (HDLBP), partial

Sign In for Pricing
View Details
Recombinant Human Vigilin (HDLBP), partial
orb2659752-03 1 mg

Recombinant Human Vigilin (HDLBP), partial

Sign In for Pricing
View Details
Interferon gamma (Type II Interferon, T Cell Interferon, MAF, IFN gamma) (MaxLight 490)
227046-ML490 100 µL

Interferon gamma (Type II Interferon, T Cell Interferon, MAF, IFN gamma) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1236551-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1236551-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details