Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vigilin (HDLBP), partial

This Recombinant Human Vigilin (HDLBP), partial spans the amino acid sequence from region 1060-1268aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

High density lipoprotein-binding protein; HDL-binding protein

UniProt

Q00341

Expression Region

1060-1268aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal sFRP-1 Antibody [DyLight 405]
NB600-499V 0.1 mL

Rabbit Polyclonal sFRP-1 Antibody [DyLight 405]

Sign In for Pricing
View Details
PSMA7P sgRNA CRISPR Lentivector (Human) (Target 1)
K1739202 1.0 µg DNA

PSMA7P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lupus La Antibody
abx133336-01 30 µL

Lupus La Antibody

Sign In for Pricing
View Details
Lupus La Antibody
abx133336-02 100 µL

Lupus La Antibody

Sign In for Pricing
View Details
Lupus La Antibody
abx133336-03 200 µL

Lupus La Antibody

Sign In for Pricing
View Details
NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (AP) discontinued
249469-AP 100 µL

NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (AP) discontinued

Sign In for Pricing
View Details