Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH9 Rabbit Polyclonal Antibody (FITC)

RSPH9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CILD12, C6orf206, MRPS18AL1

UniProt

Q9H1X1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSPH9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001180270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD73/NT5E Protein (His Tag)
PKSR030462-01 10 µg

Recombinant Rat CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat CD73/NT5E Protein (His Tag)
PKSR030462-02 50 µg

Recombinant Rat CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Recombinant HIV-1 (group M, subtype B, Isolate MN) gp120 Protein (His Tag)
PKSV030210 100 µg

Recombinant HIV-1 (group M, subtype B, Isolate MN) gp120 Protein (His Tag)

Sign In for Pricing
View Details
Tceanc2 Mouse Gene Knockout Kit (CRISPR)
KN517312 1 Kit

Tceanc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc22a27 Mouse Gene Knockout Kit (CRISPR)
KN515936 1 Kit

Slc22a27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Clec1b Rat Monoclonal Antibody [Clone ID: 17D9]
AM60018RP-N 100 Tests

Clec1b Rat Monoclonal Antibody [Clone ID: 17D9]

Sign In for Pricing
View Details