Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3GAP2 Rabbit Polyclonal Antibody (FITC)

RAB3GAP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P150, SPG69, WARBM2, RAB3GAP150, RAB3-GAP150

UniProt

Q9H2M9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAB3GAP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM189B CRISPRa sgRNA lentivector (set of three targets)(Human)
19878121 3x 1.0µg DNA

FAM189B CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Glucosamine (N-acetyl) -6-Sulfatase/G6S Monoclonal Antibody
AN300183P 100 µL

Recombinant Glucosamine (N-acetyl) -6-Sulfatase/G6S Monoclonal Antibody

Sign In for Pricing
View Details
Seasonal H1N1 Nucleocapsid Protein Antibody
5361-01 0.02 mg

Seasonal H1N1 Nucleocapsid Protein Antibody

Sign In for Pricing
View Details
Seasonal H1N1 Nucleocapsid Protein Antibody
5361-02 0.1 mg

Seasonal H1N1 Nucleocapsid Protein Antibody

Sign In for Pricing
View Details
Amn (NM_033603) Mouse Recombinant Protein
PM43549M5 20 µg

Amn (NM_033603) Mouse Recombinant Protein

Sign In for Pricing
View Details
TempPlate semi-skirted polypropylene 0.2 mL 96-well PCR plate, straight skirt, natural. Two/sleeve, 10/box.
1402-9200 10 / Box

TempPlate semi-skirted polypropylene 0.2 mL 96-well PCR plate, straight skirt, natural. Two/sleeve, 10/box.

Sign In for Pricing
View Details