Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAPCD1 Rabbit Polyclonal Antibody (HRP)

SAPCD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NG23, C6orf26

UniProt

Q5SSQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAPCD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLIHEKFSPSPLNKASSCTTQDSKERRREQNLWQQQELSRQQKGVTQPKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001034740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORBS2 Peptide - middle region
orb1998330 100 µg

SORBS2 Peptide - middle region

Sign In for Pricing
View Details
CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (MaxLight 405)
MBS6374076-01 0.1 mL

CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (MaxLight 405)

Sign In for Pricing
View Details
CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (MaxLight 405)
MBS6374076-02 5x 0.1 mL

CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (MaxLight 405)

Sign In for Pricing
View Details
Rat CVL (Cytovillin) ValidElisa Kit
EK342959 96 Well

Rat CVL (Cytovillin) ValidElisa Kit

Sign In for Pricing
View Details
Desmethylene Paroxetine Hydrochloride Salt discontinued. See 271741
008571 50 mg

Desmethylene Paroxetine Hydrochloride Salt discontinued. See 271741

Sign In for Pricing
View Details
hsa-miR-4666b miRNA Inhibitor
MBS8294647-01 10 nmol

hsa-miR-4666b miRNA Inhibitor

Sign In for Pricing
View Details