Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORBS2 Peptide - middle region

SORBS2 Peptide - middle region

Product Specifications

Product Name Alternative

ARGBP2, PRO0618

UniProt

O94875

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139142.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lamin A/C Monoclonal Antibody
E-AB-81577-01 50 µL

Recombinant Lamin A/C Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Lamin A/C Monoclonal Antibody
E-AB-81577-02 100 µL

Recombinant Lamin A/C Monoclonal Antibody

Sign In for Pricing
View Details
PON3 Mouse Monoclonal Antibody [Clone ID: OTI5C3]
CF807381 100 µg

PON3 Mouse Monoclonal Antibody [Clone ID: OTI5C3]

Sign In for Pricing
View Details
Human RNASE9 activation kit by CRISPRa
GA118161 1 Kit

Human RNASE9 activation kit by CRISPRa

Sign In for Pricing
View Details
Chlordane (Mixture of isomers)
TRC-C327030-500MG 500 mg

Chlordane (Mixture of isomers)

Sign In for Pricing
View Details
GPS2 Antibody
KC-44307-01 50 μL

GPS2 Antibody

Sign In for Pricing
View Details