Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A17 Rabbit Polyclonal Antibody (HRP)

SLC25A17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PMP34

UniProt

O43808

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC25A17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_006349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neutralizing w/ Saponin (Culture media in glass tubes/bottles)
413050 6 Bottles x 200 mL

Neutralizing w/ Saponin (Culture media in glass tubes/bottles)

Sign In for Pricing
View Details
Esophageal Cancer Related Gene 4 (ECRG4) BioAssayTM ELISA Kit (Human)
152541 96 Tests

Esophageal Cancer Related Gene 4 (ECRG4) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Genesig® Advanced kit for C.pneumoniae
Z-Path-C.pneumoniae 150 Tests

Genesig® Advanced kit for C.pneumoniae

Sign In for Pricing
View Details
MRGPRX1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1324505 3x 1.0 µg

MRGPRX1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
LRP4 (Extracellular) Antibody, Clone N207/27: HRP
SMC-418D-HRP 100 µg

LRP4 (Extracellular) Antibody, Clone N207/27: HRP

Sign In for Pricing
View Details
Recombinant Human TSLP (R127A, R130A, C-10His)
C04R-500ug 500 µg

Recombinant Human TSLP (R127A, R130A, C-10His)

Sign In for Pricing
View Details