Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP3 Rabbit Polyclonal Antibody (FITC)

NCBP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ELG, C17orf85, HSA277841

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C17orf85

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNTKKVD

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isobutylidene Diurea
TRC-I780158-500MG 500 mg

Isobutylidene Diurea

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
0407-21 100 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin B3 (CCNB3) Human Gene Knockout Kit (CRISPR)
KN417591 1 Kit

Cyclin B3 (CCNB3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RICTOR (N-term) Rabbit Polyclonal Antibody
AP13964PU-N 400 µL

RICTOR (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2604
BCLT-2604 1 Unit

Low Temperature Circulator BCLT-2604

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), Biotin conjugate, 0.1mg/mL
BNCB2067-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details