Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNJL Rabbit Polyclonal Antibody (Biotin)

CCNJL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCNJL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_078841

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGN46 Recombinant Rabbit Monoclonal Antibody [JF1-024]
ET1702-56 100 µL

TGN46 Recombinant Rabbit Monoclonal Antibody [JF1-024]

Sign In for Pricing
View Details
TXNDC4 (ERP44) (NM_015051) Human Over-expression Lysate
LC402403 20 µg

TXNDC4 (ERP44) (NM_015051) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL-35 (Interleukin 35) ELISA Kit
E-EL-H2443-01 24 Tests

Human IL-35 (Interleukin 35) ELISA Kit

Sign In for Pricing
View Details
Human IL-35 (Interleukin 35) ELISA Kit
E-EL-H2443-02 48 Tests

Human IL-35 (Interleukin 35) ELISA Kit

Sign In for Pricing
View Details
Human IL-35 (Interleukin 35) ELISA Kit
E-EL-H2443-03 96 Tests

Human IL-35 (Interleukin 35) ELISA Kit

Sign In for Pricing
View Details
CCR2 Recombinant Rabbit monoclonal Antibody [SN707]
ET1611-65-50UL 50 µL

CCR2 Recombinant Rabbit monoclonal Antibody [SN707]

Sign In for Pricing
View Details