Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT9 Rabbit Polyclonal Antibody (HRP)

KRT9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K9, CK-9, EPPK

UniProt

P35527

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000217

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ANKRD1 sgRNA gene knockout kit - Lentiviral human ANKRD1 sgRNA gene knockout kit (100)
GTR15387349 1 Vial

Lentiviral human ANKRD1 sgRNA gene knockout kit - Lentiviral human ANKRD1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Ehd3 Peptide - C-terminal region
orb2005268 100 µg

Ehd3 Peptide - C-terminal region

Sign In for Pricing
View Details
Human WNT1 Pre-designed siRNA Set A
SI018262A 1 Each

Human WNT1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
C2orf60 Recombinant Protein (Human)
RP037456 100 µg

C2orf60 Recombinant Protein (Human)

Sign In for Pricing
View Details
Histone H3, acetylated (Lys9) (MaxLight 405)
MBS6480716-01 0.1 mL

Histone H3, acetylated (Lys9) (MaxLight 405)

Sign In for Pricing
View Details
Histone H3, acetylated (Lys9) (MaxLight 405)
MBS6480716-02 5x 0.1 mL

Histone H3, acetylated (Lys9) (MaxLight 405)

Sign In for Pricing
View Details