Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ehd3 Peptide - C-terminal region

Ehd3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ehd2

UniProt

Q8R491

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ehd3 Rabbit Polyclonal Antibody (orb586099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620245

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF405S conjugate, 0.1mg/mL
BNC043548-500 1x 500 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dibutyl Phosphate
TRC-D429520-250G 250 g

Dibutyl Phosphate

Sign In for Pricing
View Details
Desoxycarbadox-D3
TRC-D296997-1MG 1 mg

Desoxycarbadox-D3

Sign In for Pricing
View Details
Mouse LDLR Antibody Pair Set
E-KAB-0309 50 µL & 100 µg

Mouse LDLR Antibody Pair Set

Sign In for Pricing
View Details
PE Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029D-01 50 Tests

PE Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
PE Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029D-02 100 Tests

PE Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details