Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUGGC Rabbit Polyclonal Antibody (FITC)

NUGGC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SLIPGC, C8orf80, SLIP-GC, HMFN0672

UniProt

Q68CJ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUGGC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSGWKYDSCKKNFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001010906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA2 (Heat Shock 70kD Protein 2, HSP70-2, HSP70-3) (AP) discontinued
247295-AP 100 µL

HSPA2 (Heat Shock 70kD Protein 2, HSP70-2, HSP70-3) (AP) discontinued

Sign In for Pricing
View Details
Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit
MBS7234284-01 48 Well

Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit

Sign In for Pricing
View Details
Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit
MBS7234284-02 96 Well

Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit

Sign In for Pricing
View Details
Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit
MBS7234284-03 5x 96 Well

Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit

Sign In for Pricing
View Details
Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit
MBS7234284-04 10x 96 Well

Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma (AGPAT3) ELISA Kit

Sign In for Pricing
View Details
Amhr2 Rabbit Polyclonal Antibody (HRP)
orb2112995 100 µL

Amhr2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details