Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amhr2 Rabbit Polyclonal Antibody (HRP)

Amhr2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

M, C14, Mrii, Misiir, Misrii

UniProt

Q8K592

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAAAQVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP5 Rabbit Polyclonal Antibody (APC-Cy7)
orb2408673 100 µL

TNFAIP5 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
ALDOC, CT (Fructose-bisphosphate Aldolase C, Brain-type Aldolase, ALDO, ALDC) (Biotin) discontinued
A1335-50-Biotin 200 µL

ALDOC, CT (Fructose-bisphosphate Aldolase C, Brain-type Aldolase, ALDO, ALDC) (Biotin) discontinued

Sign In for Pricing
View Details
Anti-CD77 Antibody (38.13)
FGN55610 100 μg

Anti-CD77 Antibody (38.13)

Sign In for Pricing
View Details
Darifenacin HBr
FD10806-01 1000 mg

Darifenacin HBr

Sign In for Pricing
View Details
Darifenacin HBr
FD10806-02 2000 mg

Darifenacin HBr

Sign In for Pricing
View Details
Darifenacin HBr
FD10806-03 5000 mg

Darifenacin HBr

Sign In for Pricing
View Details