Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1L2 Rabbit Polyclonal Antibody (HRP)

ALG1L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

C9J202

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129624.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA
32-8363-10 10 µg

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA

Sign In for Pricing
View Details
SK-N-DZ Cell Complete Medium
CM-0850 4x 125 mL

SK-N-DZ Cell Complete Medium

Sign In for Pricing
View Details
Anti-SynDIG1/Tmem90b Antibody FL594 Conjugate
75-251-FL594 200 µL

Anti-SynDIG1/Tmem90b Antibody FL594 Conjugate

Sign In for Pricing
View Details
FAM172A Knockout HT29 Polyclonal Cells
ARG14712 1 Million

FAM172A Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
copine 1 Double Nickase Plasmid (m2)
sc-435225-NIC-2 20 µg

copine 1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Med9 AAV siRNA Pooled Vector
28321164 1.0 µg

Med9 AAV siRNA Pooled Vector

Sign In for Pricing
View Details