Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA

Source: E. coli. MW :14.1kD. Recombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-Thr211 is expressed. Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Product Specifications

Gene Name

PDGFA

Gene ID

5154

UniProt

P04085

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Keratocan (KERA)
TRV-0059525-01 20 µL

Monoclonal Antibody to Keratocan (KERA)

Sign In for Pricing
View Details
Monoclonal Antibody to Keratocan (KERA)
TRV-0059525-02 100 µL

Monoclonal Antibody to Keratocan (KERA)

Sign In for Pricing
View Details
Monoclonal Antibody to Keratocan (KERA)
TRV-0059525-03 200 µL

Monoclonal Antibody to Keratocan (KERA)

Sign In for Pricing
View Details
Monoclonal Antibody to Keratocan (KERA)
TRV-0059525-04 1 mL

Monoclonal Antibody to Keratocan (KERA)

Sign In for Pricing
View Details
FLR1 Antibody
orb846161 2 mg

FLR1 Antibody

Sign In for Pricing
View Details
PIC 606-DIA 100-B7527 AC Signs
222690 Card of 1 Pictogram(s)

PIC 606-DIA 100-B7527 AC Signs

Sign In for Pricing
View Details