Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CWF19L1 Rabbit Polyclonal Antibody (HRP)

CWF19L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C19L1, hDrn1, SCAR17

UniProt

Q69YN2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CWF19L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Coagulation Factor IX/F9 Protein (His Tag)
PKSH031109 50 µg

Recombinant Human Coagulation Factor IX/F9 Protein (His Tag)

Sign In for Pricing
View Details
Elab Bright™ Violet 421 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353Q2 50 Tests

Elab Bright™ Violet 421 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Horizontal Laminar Airflow BLHZ-201
BLHZ-201 1 Unit

Horizontal Laminar Airflow BLHZ-201

Sign In for Pricing
View Details
KDELR3 Rabbit Polyclonal Antibody
AP01401PU-N 100 µg

KDELR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503670 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602814 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details