Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAXO2 Rabbit Polyclonal Antibody (HRP)

SAXO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM154B

UniProt

Q658L1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM154B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IFN-λ1/IL-29 Protein (His Tag)
PKSH033639-01 10 µg

Recombinant Human IFN-λ1/IL-29 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IFN-λ1/IL-29 Protein (His Tag)
PKSH033639-02 50 µg

Recombinant Human IFN-λ1/IL-29 Protein (His Tag)

Sign In for Pricing
View Details
IL17 (IL17A) Human Gene Knockout Kit (CRISPR)
KN418057 1 Kit

IL17 (IL17A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse TNNI3/cTn-I (Troponin I Type 3, Cardiac) CLIA Kit
E-CL-M0668-01 24 Tests

Mouse TNNI3/cTn-I (Troponin I Type 3, Cardiac) CLIA Kit

Sign In for Pricing
View Details
Mouse TNNI3/cTn-I (Troponin I Type 3, Cardiac) CLIA Kit
E-CL-M0668-02 48 Tests

Mouse TNNI3/cTn-I (Troponin I Type 3, Cardiac) CLIA Kit

Sign In for Pricing
View Details
Mouse TNNI3/cTn-I (Troponin I Type 3, Cardiac) CLIA Kit
E-CL-M0668-03 96 Tests

Mouse TNNI3/cTn-I (Troponin I Type 3, Cardiac) CLIA Kit

Sign In for Pricing
View Details