Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A2 Rabbit Polyclonal Antibody (Biotin)

OR10A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OST363, OR10A2P, OR11-82, OR11-86

UniProt

Q9H208

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYISLSLTYFRPKSNNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J (nuoJ)
orb2918470-01 20 µg

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J (nuoJ)

Sign In for Pricing
View Details
Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J (nuoJ)
orb2918470-02 100 µg

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J (nuoJ)

Sign In for Pricing
View Details
Lentiviral human DYSF shRNA (UAS) - Lentiviral human DYSF shRNA (UAS, iRFP) (25)
GTR15102878 1 Vial

Lentiviral human DYSF shRNA (UAS) - Lentiviral human DYSF shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human TSR2 Recombinant Protein
PROTQ969E8-4ug 4 µg

Human TSR2 Recombinant Protein

Sign In for Pricing
View Details
Myeloperoxidase protein
30-1185 0.1 mg

Myeloperoxidase protein

Sign In for Pricing
View Details
PMPCB, NT (PMPCB, MPPB, Mitochondrial-processing peptidase subunit beta, Beta-MPP, P-52) (MaxLight 550) discontinued
040202-ML550 100 µL

PMPCB, NT (PMPCB, MPPB, Mitochondrial-processing peptidase subunit beta, Beta-MPP, P-52) (MaxLight 550) discontinued

Sign In for Pricing
View Details