Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J (nuoJ)

This Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J (nuoJ) spans the amino acid sequence from region 1-205.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit J, EC= 1.6.99.5, NADH dehydrogenase I subunit J, NDH-1 subunit J

UniProt

Q68VV9

Expression Region

1-205

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIFFYLFTTLIIISSLCVVLSKNSVYSVLWLIFTFINAAGLMILLGAEFLAMLLIVIYV GAVAVLFLFVIMMLDINFNQAITKLRENLSLSIFITLIMFVDLVITVILSTKNINHSSNI SFAIANNISNTKAIGSVLYTDFMLPFQMAGLILFVAMISCITLTLKKRERVKYQDIRKQL SHNKGNVILMTKPILNKGVENIKYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF740 conjugate, 0.1mg/mL
BNC742641-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF488A conjugate, 0.1mg/mL
BNC882984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details