Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

R3HCC1 Rabbit Polyclonal Antibody (HRP)

R3HCC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9Y3T6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human R3HCC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDDTHALGIFPCLASAAEALTREFSVLKIRPLTQGTKQSKLKALQRPKLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129580

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAS Related GPR Member X2 (MRGPRX2) ELISA Kit
MBS2709576-01 24 Strip Well

MAS Related GPR Member X2 (MRGPRX2) ELISA Kit

Sign In for Pricing
View Details
MAS Related GPR Member X2 (MRGPRX2) ELISA Kit
MBS2709576-02 48 Well

MAS Related GPR Member X2 (MRGPRX2) ELISA Kit

Sign In for Pricing
View Details
MAS Related GPR Member X2 (MRGPRX2) ELISA Kit
MBS2709576-03 96 Well

MAS Related GPR Member X2 (MRGPRX2) ELISA Kit

Sign In for Pricing
View Details
MAS Related GPR Member X2 (MRGPRX2) ELISA Kit
MBS2709576-04 5x 96 Well

MAS Related GPR Member X2 (MRGPRX2) ELISA Kit

Sign In for Pricing
View Details
MAS Related GPR Member X2 (MRGPRX2) ELISA Kit
MBS2709576-05 10x 96 Well

MAS Related GPR Member X2 (MRGPRX2) ELISA Kit

Sign In for Pricing
View Details
GWB-C3D70A-1MG - Creatine Kinase-BB Isoenzyme (CK-BB) Antibody
GWB-C3D70A-1MG 1 mg

GWB-C3D70A-1MG - Creatine Kinase-BB Isoenzyme (CK-BB) Antibody

Sign In for Pricing
View Details