Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM47E Rabbit Polyclonal Antibody (HRP)

FAM47E Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZV65

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM47E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Maspin (serpin B5) ELISA Kit
GTR10360967 96 Well

Human Maspin (serpin B5) ELISA Kit

Sign In for Pricing
View Details
Mrpl48 Peptide - C-terminal region
orb2005947 100 µg

Mrpl48 Peptide - C-terminal region

Sign In for Pricing
View Details
Human C-C chemokine receptor type 4, CCR4 ELISA KIT
ELI-06171h 96 Tests

Human C-C chemokine receptor type 4, CCR4 ELISA KIT

Sign In for Pricing
View Details
C2orf27B AAV siRNA Pooled Vector
14397161 1.0 µg

C2orf27B AAV siRNA Pooled Vector

Sign In for Pricing
View Details
53BP1 Rabbit pAb
APA2578-01 30 µL

53BP1 Rabbit pAb

Sign In for Pricing
View Details
53BP1 Rabbit pAb
APA2578-02 50 μL

53BP1 Rabbit pAb

Sign In for Pricing
View Details