Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl48 Peptide - C-terminal region

Mrpl48 Peptide - C-terminal region

Product Specifications

UniProt

D3ZDX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl48 Rabbit Polyclonal Antibody (orb583326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099752

Preservative

Lyophilized powder

AA Sequence

ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAC3 Conjugated Antibody
C46233 100 µL

STAC3 Conjugated Antibody

Sign In for Pricing
View Details
B-RAF (Phospho-Ser446) Antibody
12064-01 50 µL

B-RAF (Phospho-Ser446) Antibody

Sign In for Pricing
View Details
B-RAF (Phospho-Ser446) Antibody
12064-02 100 µL

B-RAF (Phospho-Ser446) Antibody

Sign In for Pricing
View Details
Mouse IFI30 shRNA Plasmid
abx975355-01 150 µg

Mouse IFI30 shRNA Plasmid

Sign In for Pricing
View Details
Mouse IFI30 shRNA Plasmid
abx975355-02 300 µg

Mouse IFI30 shRNA Plasmid

Sign In for Pricing
View Details
ALDH2 3'UTR GFP Stable Cell Line
TU050603 1.0 mL

ALDH2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details